Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-11 (IL11)

Recombinant Human Interleukin-11 (IL11)

Product Specifications

Product Name Alternative

Adipogenesis inhibitory factor

UniProt

P20809

Expression Region

22-199aa

Tag

N-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kallikrein-15, Human (HEK293, Fc)
HY-P77047 1 Each

Kallikrein-15, Human (HEK293, Fc)

Sign In for Pricing
View Details
E2F-4 (D-7) Alexa Fluor® 546
sc-398543 AF546 200 µg/mL

E2F-4 (D-7) Alexa Fluor® 546

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]
E-AB-F1093I-01 50 Tests

PE/Cyanine5.5 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]
E-AB-F1093I-02 100 Tests

PE/Cyanine5.5 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]
E-AB-F1093I-03 2x 100 Tests

PE/Cyanine5.5 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]

Sign In for Pricing
View Details
Recombinant Brucella Abortus BAB1_2156 Protein (aa 1-168)
VAng-Lsx5197-500gEcoli 500 µg (E. coli)

Recombinant Brucella Abortus BAB1_2156 Protein (aa 1-168)

Sign In for Pricing
View Details