Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial

Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial

Product Specifications

Product Name Alternative

Cytokine receptor-like 2; IL-XR; Thymic stromal lymphopoietin protein receptor

UniProt

Q9HC73

Expression Region

25-231aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCG2 Human Gene Knockout Kit (CRISPR)
KN205640RB 1 Kit

ABCG2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant MLKL Antibody
RC-7050-01 50 μL

Recombinant MLKL Antibody

Sign In for Pricing
View Details
Recombinant MLKL Antibody
RC-7050-02 100 µL

Recombinant MLKL Antibody

Sign In for Pricing
View Details
Recombinant MLKL Antibody
RC-7050-03 1 mL

Recombinant MLKL Antibody

Sign In for Pricing
View Details
Biosafety Transport Box BTBT-201
BTBT-201 1 Unit

Biosafety Transport Box BTBT-201

Sign In for Pricing
View Details
VR1 (TRPV1) Human Gene Knockout Kit (CRISPR)
KN217653RB 1 Kit

VR1 (TRPV1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details