Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial

Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial

Product Specifications

Product Name Alternative

Cytokine receptor-like 2; IL-XR; Thymic stromal lymphopoietin protein receptor

UniProt

Q9HC73

Expression Region

25-231aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Follicle Stimulating Hormone (FSH) ELISA Kit
EK14091 48 Tests

Porcine Follicle Stimulating Hormone (FSH) ELISA Kit

Sign In for Pricing
View Details
14-Deoxy-11,12-didehydroandrographolide
C01170 5 mg

14-Deoxy-11,12-didehydroandrographolide

Sign In for Pricing
View Details
RAD51 Antibody
A48890-100UL 100 µL

RAD51 Antibody

Sign In for Pricing
View Details
CYP51P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV722309 1.0 µg DNA

CYP51P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
OR10A5 Polyclonal Antibody
bs-11631R 100 µL

OR10A5 Polyclonal Antibody

Sign In for Pricing
View Details
Stanniocalcin 1 (STC1) (C-term) Rabbit Polyclonal Antibody
AP54070PU-N 400 µL

Stanniocalcin 1 (STC1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details