Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Guanylate cyclase activator 2B (Guca2b)

Recombinant Mouse Guanylate cyclase activator 2B (Guca2b)

Product Specifications

Product Name Alternative

Guca2b

UniProt

O09051

Expression Region

22-106aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc25a4 Mouse shRNA Lentiviral Particle (Locus ID 11739)
TL518929V 500 µL Each

Slc25a4 Mouse shRNA Lentiviral Particle (Locus ID 11739)

Sign In for Pricing
View Details
PLA2G3 Polyclonal Antibody
E-AB-91870-01 60 µL

PLA2G3 Polyclonal Antibody

Sign In for Pricing
View Details
PLA2G3 Polyclonal Antibody
E-AB-91870-02 120 µL

PLA2G3 Polyclonal Antibody

Sign In for Pricing
View Details
PLA2G3 Polyclonal Antibody
E-AB-91870-03 200 µL

PLA2G3 Polyclonal Antibody

Sign In for Pricing
View Details
Rat FADS3 shRNA Plasmid
abx988169-01 150 µg

Rat FADS3 shRNA Plasmid

Sign In for Pricing
View Details
Rat FADS3 shRNA Plasmid
abx988169-02 300 µg

Rat FADS3 shRNA Plasmid

Sign In for Pricing
View Details