Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prostate-specific antigen (KLK3)

Recombinant Human Prostate-specific antigen (KLK3)

Product Specifications

Product Name Alternative

Gamma-seminoprotein; Kallikrein-3; P-30 antigen; Semenogelase

UniProt

P07288

Expression Region

18-261aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CaBP4 shRNA (h) Lentiviral Particles
sc-105173-V 200 µL

CaBP4 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
GM-CSF
M10-238S 5 µg

GM-CSF

Sign In for Pricing
View Details
Anti-Human IL-16
RH161162 100 µg

Anti-Human IL-16

Sign In for Pricing
View Details
IFluor® 790 Anti-human CD44 Antibody *HERMES-1*
104430M0-AAT 100 Tests

IFluor® 790 Anti-human CD44 Antibody *HERMES-1*

Sign In for Pricing
View Details
Phospho-FHIT (Tyr114) Polyclonal Antibody, FITC Conjugated
bs-3146R-FITC 100 µL

Phospho-FHIT (Tyr114) Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
FOLR1 Antibody-middle region
MBS3249784-01 0.1 mL

FOLR1 Antibody-middle region

Sign In for Pricing
View Details