Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Major allergen I polypeptide chain 2 (CH2)

Recombinant Cat Major allergen I polypeptide chain 2 (CH2)

Product Specifications

Product Name Alternative

AG4; Allergen Cat-1; Allergen Fel d I-B

UniProt

P30440

Expression Region

18-109aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKDCMGEAVQNTVEDLKLNTLGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PPM1K activation kit by CRISPRa
GA115848 1 Kit

Human PPM1K activation kit by CRISPRa

Sign In for Pricing
View Details
Collagen III (COL3A1) Mouse Monoclonal Antibody [Clone ID: Col-29]
AM20612PU-N 100 µg

Collagen III (COL3A1) Mouse Monoclonal Antibody [Clone ID: Col-29]

Sign In for Pricing
View Details
Avi-Tag Monoclonal Antibody
E-AB-48008-01 25 µL

Avi-Tag Monoclonal Antibody

Sign In for Pricing
View Details
Avi-Tag Monoclonal Antibody
E-AB-48008-02 100 µL

Avi-Tag Monoclonal Antibody

Sign In for Pricing
View Details
Texas Red Conjugated Robinia pseudoacacia (Black Locust) -RPA-
T-4101-1 1 mg

Texas Red Conjugated Robinia pseudoacacia (Black Locust) -RPA-

Sign In for Pricing
View Details
PCNA (Proliferating Cell Nuclear Antigen) (G1- & S-phase Marker) (PC5), CF568 conjugate, 0.1mg/mL
BNC683065-500 1x 500 µL

PCNA (Proliferating Cell Nuclear Antigen) (G1- & S-phase Marker) (PC5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details