Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Immunodominant staphylococcal antigen B (isaB)

Recombinant Staphylococcus aureus Immunodominant staphylococcal antigen B (isaB)

Product Specifications

Product Name Alternative

IsaB; SACOL2660

UniProt

Q5HCQ9

Expression Region

37-175aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Staphylococcus aureus (strain COL)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AITPYYTYNGYIGNNANFILDKNFINAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQKAYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LysoBrite™ NIR
22641-AAT 500 Tests

LysoBrite™ NIR

Sign In for Pricing
View Details
HOXD3 Human Gene Knockout Kit (CRISPR)
KN402456 1 Kit

HOXD3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
M-TETPO
TRC-M874890-1MG 1 mg

M-TETPO

Sign In for Pricing
View Details
Blonanserin
TRC-B595850-10MG 10 mg

Blonanserin

Sign In for Pricing
View Details
Human CRTAM activation kit by CRISPRa
GA111164 1 Kit

Human CRTAM activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS629957 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details