Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Immunodominant staphylococcal antigen B (isaB)

Recombinant Staphylococcus aureus Immunodominant staphylococcal antigen B (isaB)

Product Specifications

Product Name Alternative

IsaB; SACOL2660

UniProt

Q5HCQ9

Expression Region

37-175aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Staphylococcus aureus (strain COL)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AITPYYTYNGYIGNNANFILDKNFINAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQKAYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER2 Antibody (ERBB2) (phospho-Y1222)
F52420-0.08ML 0.08 mL

HER2 Antibody (ERBB2) (phospho-Y1222)

Sign In for Pricing
View Details
CFC1B Human Gene Knockout Kit (CRISPR)
KN416675 1 Kit

CFC1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1, N6-Etheno-2'-deoxyadenosine-13C5
TRC-E677905-2.5MG 2.5 mg

1, N6-Etheno-2'-deoxyadenosine-13C5

Sign In for Pricing
View Details
PARVB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H9]
TA505714AM 100 µL

PARVB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H9]

Sign In for Pricing
View Details
TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI10F8]
CF808440 100 µg

TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI10F8]

Sign In for Pricing
View Details
TentaGel® R HMBA
R28014.50G 50 g

TentaGel® R HMBA

Sign In for Pricing
View Details