Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adhesion G protein-coupled receptor L3 (ADGRL3), partial

Recombinant Human Adhesion G protein-coupled receptor L3 (ADGRL3), partial

Product Specifications

Product Name Alternative

Calcium-independent alpha-latrotoxin receptor 3; Latrophilin-3; Lectomedin-3

UniProt

Q9HAR2

Expression Region

20-425aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FSRAPIPMAVVRRELSCESYPIELRCPGTDVIMIESANYGRTDDKICDSDPAQMENIRCYLPDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTYKYLEVQYECVPYKVEQKVFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGTWDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSLVDVPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSGQAHHGQVSYISPPIHLDSELERPSVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (KRT8) (KRT8/2115), CF594 conjugate, 0.1mg/mL
BNC942115-100 1x 100 µL

Cytokeratin 8 (KRT8) (KRT8/2115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Double Stranded DNA (dsDNA) (AE-2), CF640R conjugate, 0.1mg/mL
BNC400946-100 1x 100 µL

Double Stranded DNA (dsDNA) (AE-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE Anti-Mouse CD14 Antibody
RD21940F-01 25 µg

PE Anti-Mouse CD14 Antibody

Sign In for Pricing
View Details
PE Anti-Mouse CD14 Antibody
RD21940F-02 100 µg

PE Anti-Mouse CD14 Antibody

Sign In for Pricing
View Details
Piracetam-d8
TRC-P500802-1MG 1 mg

Piracetam-d8

Sign In for Pricing
View Details
HMGCR Recombinant Rabbit monoclonal Antibody
HA750345 100 µL

HMGCR Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details