Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heparanase (HPSE), partial

Recombinant Human Heparanase (HPSE), partial

Product Specifications

Product Name Alternative

Endo-glucoronidase; Heparanase-1

UniProt

Q9Y251

Expression Region

36-109aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDVVDLDFFTQEPLHLVSPSFLSVTIDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB8, NT (PSMB8, LMP7, PSMB5i, RING10, Y2, Proteasome subunit beta type-8, Low molecular mass protein 7, Macropain subunit C13, Multicatalytic endopeptidase complex subunit C13, Proteasome component C13, Proteasome subunit beta-5i, Really interesting new
MBS6338210-01 0.1 mL

PSMB8, NT (PSMB8, LMP7, PSMB5i, RING10, Y2, Proteasome subunit beta type-8, Low molecular mass protein 7, Macropain subunit C13, Multicatalytic endopeptidase complex subunit C13, Proteasome component C13, Proteasome subunit beta-5i, Really interesting new

Sign In for Pricing
View Details
PSMB8, NT (PSMB8, LMP7, PSMB5i, RING10, Y2, Proteasome subunit beta type-8, Low molecular mass protein 7, Macropain subunit C13, Multicatalytic endopeptidase complex subunit C13, Proteasome component C13, Proteasome subunit beta-5i, Really interesting new
MBS6338210-02 5x 0.1 mL

PSMB8, NT (PSMB8, LMP7, PSMB5i, RING10, Y2, Proteasome subunit beta type-8, Low molecular mass protein 7, Macropain subunit C13, Multicatalytic endopeptidase complex subunit C13, Proteasome component C13, Proteasome subunit beta-5i, Really interesting new

Sign In for Pricing
View Details
PRMT6 Blocking Peptide
MBS9632622-01 1 mg

PRMT6 Blocking Peptide

Sign In for Pricing
View Details
PRMT6 Blocking Peptide
MBS9632622-02 5x 1 mg

PRMT6 Blocking Peptide

Sign In for Pricing
View Details
PI 3 Kinase R4 Rabbit mAb
RDSA66041 100 µL

PI 3 Kinase R4 Rabbit mAb

Sign In for Pricing
View Details
Rabbit Anti-Guinea Pig IgM Secondary Antibody-RBITC
TMAB-02050RBITC-01 100 µL

Rabbit Anti-Guinea Pig IgM Secondary Antibody-RBITC

Sign In for Pricing
View Details