Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement component C9 (C9), partial

Product Specifications

Abbreviation

Recombinant Human C9 protein, partial

Gene Name

C9

UniProt

P02748

Expression Region

22-265aa

Organism

Homo sapiens (Human)

Target Sequence

QYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGLCNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASSISLH

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C9 is the pore-forming subunit of the MAC.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.3 kDa

References & Citations

"The first transmembrane region of complement component-9 acts as a brake on its self-assembly." Spicer B.A., Law R.H.P., Caradoc-Davies T.T., Ekkel S.M., Bayly-Jones C., Pang S.S., Conroy P.J., Ramm G., Radjainia M., Venugopal H., Whisstock J.C., Dunstone M.A. Nat. Commun. 9:3266-3266 (2018)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEC1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-61551R-BF680-01 20 µL

HEC1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
HEC1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-61551R-BF680-02 100 µL

HEC1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
(4R,4'R) -2,2'- (1,3-Diphenylpropane-2,2-diyl) bis (4-benzyl-4,5-dihydrooxazole)
OR1061489-01 100 mg

(4R,4'R) -2,2'- (1,3-Diphenylpropane-2,2-diyl) bis (4-benzyl-4,5-dihydrooxazole)

Sign In for Pricing
View Details
(4R,4'R) -2,2'- (1,3-Diphenylpropane-2,2-diyl) bis (4-benzyl-4,5-dihydrooxazole)
OR1061489-02 250 mg

(4R,4'R) -2,2'- (1,3-Diphenylpropane-2,2-diyl) bis (4-benzyl-4,5-dihydrooxazole)

Sign In for Pricing
View Details
(4R,4'R) -2,2'- (1,3-Diphenylpropane-2,2-diyl) bis (4-benzyl-4,5-dihydrooxazole)
OR1061489-03 1 g

(4R,4'R) -2,2'- (1,3-Diphenylpropane-2,2-diyl) bis (4-benzyl-4,5-dihydrooxazole)

Sign In for Pricing
View Details
Phospho-Vimentin Mouse Monoclonal Antibody
orb2960589-01 50 µg

Phospho-Vimentin Mouse Monoclonal Antibody

Sign In for Pricing
View Details