Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Negative regulator of P-body association (NBDY)

This Recombinant Human Negative regulator of P-body association (NBDY) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Negative regulator of P-body association; P-body dissociating protein; Protein NoBody; NBDY LINC01420

UniProt

A0A0U1RRE5

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGDQPCASGRSTLPPGNAREAKPPKKRCLLAPRWDYPEGTPNGGSTTLPSAPPPASAGLKSHPPPPEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRR13 Protein Vector (Rat) (pPB-N-His)
PV296495 500 ng

PRR13 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
MREG (Melanoregulin, DSU, Dilute Suppressor Protein Homolog, FLJ10116, MGC90296, HDCGA21P) (APC)
129847-APC 100 µL

MREG (Melanoregulin, DSU, Dilute Suppressor Protein Homolog, FLJ10116, MGC90296, HDCGA21P) (APC)

Sign In for Pricing
View Details
ELISA Kit For Mast/stem cell growth factor receptor Kit
E0121d 96 Tests

ELISA Kit For Mast/stem cell growth factor receptor Kit

Sign In for Pricing
View Details
Rpl10a Rat shRNA Plasmid (Locus ID 81729)
TR711195 1 Kit

Rpl10a Rat shRNA Plasmid (Locus ID 81729)

Sign In for Pricing
View Details
CHM Peptide - N-terminal region
MBS3225099-01 0.1 mg

CHM Peptide - N-terminal region

Sign In for Pricing
View Details
CHM Peptide - N-terminal region
MBS3225099-02 5x 0.1 mg

CHM Peptide - N-terminal region

Sign In for Pricing
View Details