Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL6, Rat (His)

The CCL6 protein is part of the intercrine beta family, a component of chemokines involved in intercellular communication and immune responses. In this family, CCL6 may play an important role in regulating inflammatory processes and cellular interactions. CCL6 Protein, Rat (His) is the recombinant rat-derived CCL6 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CCL6 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl6-protein-rat-n-his.html

Purity

96.90

Smiles

GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA

Molecular Formula

287910 (Gene_ID) Q68FP3 (G22-A115) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®594 Monoclonal Mouse Anti-6X His IgG, 1 mg/mL
#20229 1x 50 µL

CF®594 Monoclonal Mouse Anti-6X His IgG, 1 mg/mL

Sign In for Pricing
View Details
ELOVL1 Rabbit Polyclonal Antibody
AP01399PU-N 100 µg

ELOVL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calcium Oxide
TRC-C145650-50G 50 g

Calcium Oxide

Sign In for Pricing
View Details
trans-Resveratrol 3-O-Beta-D-Glucuronide
TRC-R150015-5MG 5 mg

trans-Resveratrol 3-O-Beta-D-Glucuronide

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD11a Antibody[38]
AN00569J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD11a Antibody[38]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD11a Antibody[38]
AN00569J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD11a Antibody[38]

Sign In for Pricing
View Details