Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL6, Rat (His)

The CCL6 protein is part of the intercrine beta family, a component of chemokines involved in intercellular communication and immune responses. In this family, CCL6 may play an important role in regulating inflammatory processes and cellular interactions. CCL6 Protein, Rat (His) is the recombinant rat-derived CCL6 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CCL6 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl6-protein-rat-n-his.html

Purity

96.90

Smiles

GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA

Molecular Formula

287910 (Gene_ID) Q68FP3 (G22-A115) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOX 1 (OLR1) Rabbit Polyclonal Antibody
TA371178 100 µL

LOX 1 (OLR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EFHC1 (NM_001172420) Human Over-expression Lysate
LY433359 100 µg

EFHC1 (NM_001172420) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CD62E Recombinant Rabbit monoclonal Antibody
HA723636 100 µL

Human CD62E Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD45 / LCA (CD45RB) Rat Monoclonal Antibody [Clone ID: 16A]
CL029FX 300 µg

CD45 / LCA (CD45RB) Rat Monoclonal Antibody [Clone ID: 16A]

Sign In for Pricing
View Details
Propiverine Hydrochloride
TRC-P828000-1G 1 g

Propiverine Hydrochloride

Sign In for Pricing
View Details
Tissue Total RNA, Spleen
CR562327 5 µg

Tissue Total RNA, Spleen

Sign In for Pricing
View Details