Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL6, Rat (His)

The CCL6 protein is part of the intercrine beta family, a component of chemokines involved in intercellular communication and immune responses. In this family, CCL6 may play an important role in regulating inflammatory processes and cellular interactions. CCL6 Protein, Rat (His) is the recombinant rat-derived CCL6 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CCL6 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl6-protein-rat-n-his.html

Purity

96.90

Smiles

GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA

Molecular Formula

287910 (Gene_ID) Q68FP3 (G22-A115) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CTLA-4 (9H10) In Vivo Antibody - Low Endotoxin
ICH1084-100mg 100 mg

Anti-CTLA-4 (9H10) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Human Epsin 2 (EPN2) activation kit by CRISPRa
GA107900 1 Kit

Human Epsin 2 (EPN2) activation kit by CRISPRa

Sign In for Pricing
View Details
SUN1 Human Gene Knockout Kit (CRISPR)
KN424605 1 Kit

SUN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TTDA (GTF2H5) activation kit by CRISPRa
GA118391 1 Kit

Human TTDA (GTF2H5) activation kit by CRISPRa

Sign In for Pricing
View Details
p-Terphenyl-d14
TRC-T116682-1G 1 g

p-Terphenyl-d14

Sign In for Pricing
View Details
Human ZCCHC8 activation kit by CRISPRa
GA110809 1 Kit

Human ZCCHC8 activation kit by CRISPRa

Sign In for Pricing
View Details