Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small ubiquitin-related modifier 5 (SUMO5)

This Recombinant Human Small ubiquitin-related modifier 5 (SUMO5) spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small ubiquitin-related modifier 5; SUMO-5; SUMO1 pseudogene 1; Ubiquitin-like 2; Ubiquitin-like 6; SUMO1P1 SUMO5 UBL2 UBL6

UniProt

G2XKQ0

Expression Region

1-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSDLEAKPSTEHLGDKIKDEDIKLRVIGQDSSEIHFKVKMTTPLKKLKKSYCQRQGVPVNSLRFLFEGQRIADNHTPEELGMEEEDVIEVYQEQIGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GFRA3/GFR-alpha-3 Protein (His & Fc Tag)
PKSH031754 100 µg

Recombinant Human GFRA3/GFR-alpha-3 Protein (His & Fc Tag)

Sign In for Pricing
View Details
Human GLCCI1 activation kit by CRISPRa
GA114400 1 Kit

Human GLCCI1 activation kit by CRISPRa

Sign In for Pricing
View Details
Uric Acid (UA) Fluorometric Assay Kit
E-BC-F018-01 48 T (32 samples)

Uric Acid (UA) Fluorometric Assay Kit

Sign In for Pricing
View Details
Uric Acid (UA) Fluorometric Assay Kit
E-BC-F018-02 96 T (80 samples)

Uric Acid (UA) Fluorometric Assay Kit

Sign In for Pricing
View Details
ASTE1 Rabbit Polyclonal Antibody
TA370557 100 µL

ASTE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PODN activation kit by CRISPRa
GA114997 1 Kit

Human PODN activation kit by CRISPRa

Sign In for Pricing
View Details