Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small ubiquitin-related modifier 5 (SUMO5)

This Recombinant Human Small ubiquitin-related modifier 5 (SUMO5) spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small ubiquitin-related modifier 5; SUMO-5; SUMO1 pseudogene 1; Ubiquitin-like 2; Ubiquitin-like 6; SUMO1P1 SUMO5 UBL2 UBL6

UniProt

G2XKQ0

Expression Region

1-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSDLEAKPSTEHLGDKIKDEDIKLRVIGQDSSEIHFKVKMTTPLKKLKKSYCQRQGVPVNSLRFLFEGQRIADNHTPEELGMEEEDVIEVYQEQIGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ywhae Mouse Gene Knockout Kit (CRISPR)
KN519572 1 Kit

Ywhae Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Cynomolgus Fc gamma RIIIA/FCGR3A/CD16a (C-6His)
PKSQ050099-01 10 µg

Recombinant Cynomolgus Fc gamma RIIIA/FCGR3A/CD16a (C-6His)

Sign In for Pricing
View Details
Recombinant Cynomolgus Fc gamma RIIIA/FCGR3A/CD16a (C-6His)
PKSQ050099-02 50 µg

Recombinant Cynomolgus Fc gamma RIIIA/FCGR3A/CD16a (C-6His)

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), 0.2mg/mL
BNUB0745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), 0.2mg/mL

Sign In for Pricing
View Details
Human KRTAP21-2 activation kit by CRISPRa
GA117358 1 Kit

Human KRTAP21-2 activation kit by CRISPRa

Sign In for Pricing
View Details
FAM98A Rabbit Polyclonal Antibody
TA368306 100 µL

FAM98A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details