Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small ubiquitin-related modifier 5 (SUMO5)

This Recombinant Human Small ubiquitin-related modifier 5 (SUMO5) spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small ubiquitin-related modifier 5; SUMO-5; SUMO1 pseudogene 1; Ubiquitin-like 2; Ubiquitin-like 6; SUMO1P1 SUMO5 UBL2 UBL6

UniProt

G2XKQ0

Expression Region

1-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSDLEAKPSTEHLGDKIKDEDIKLRVIGQDSSEIHFKVKMTTPLKKLKKSYCQRQGVPVNSLRFLFEGQRIADNHTPEELGMEEEDVIEVYQEQIGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PTGS2 Rabbit Monoclonal Antibody
2610-01 20 μL

Anti-PTGS2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-PTGS2 Rabbit Monoclonal Antibody
2610-02 100 μL

Anti-PTGS2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PIC E008-250x250-PP-CRD/1 Facility & Office Signs (No Adhesive)
815083 1 Card (1 Panel (s) x 1 Pack)

PIC E008-250x250-PP-CRD/1 Facility & Office Signs (No Adhesive)

Sign In for Pricing
View Details
Human Influenza viruses IgG (FLU-IgG) ELISA Kit
YP-W11041-01 48 Tests

Human Influenza viruses IgG (FLU-IgG) ELISA Kit

Sign In for Pricing
View Details
Human Influenza viruses IgG (FLU-IgG) ELISA Kit
YP-W11041-02 96 Tests

Human Influenza viruses IgG (FLU-IgG) ELISA Kit

Sign In for Pricing
View Details
Troponin I (FITC)
227215-FITC 100 µL

Troponin I (FITC)

Sign In for Pricing
View Details