Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 22 (SIM22), partial

This Recombinant Human Transforming growth factor-beta receptor type 3-like protein (TGR3L), partial spans the amino acid sequence from region 17-244. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 22; Cancer-associated small integral membrane open reading frame 1; SMIM22 CASIMO1

UniProt

K7EJ46

Expression Region

1-31

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAVSTEELEATVQEVLGRLKSHQFFQSTWDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fermt3 (NM_153795) Mouse Tagged ORF Clone
MR209883 10 µg

Fermt3 (NM_153795) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Leucine-Rich Repeats And Immunoglobulin-Like Domains Protein 1 (LRIG1) Antibody
abx455700-01 50 µg

Leucine-Rich Repeats And Immunoglobulin-Like Domains Protein 1 (LRIG1) Antibody

Sign In for Pricing
View Details
Leucine-Rich Repeats And Immunoglobulin-Like Domains Protein 1 (LRIG1) Antibody
abx455700-02 100 µg

Leucine-Rich Repeats And Immunoglobulin-Like Domains Protein 1 (LRIG1) Antibody

Sign In for Pricing
View Details
TYRP1 sgRNA CRISPR Lentivector set (Human)
K2566001 3x 1.0 µg

TYRP1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Serine/threonine-protein kinase 17B, STK17B ELISA Kit
MBS9331850-01 48 Well

Mouse Serine/threonine-protein kinase 17B, STK17B ELISA Kit

Sign In for Pricing
View Details
Mouse Serine/threonine-protein kinase 17B, STK17B ELISA Kit
MBS9331850-02 96 Well

Mouse Serine/threonine-protein kinase 17B, STK17B ELISA Kit

Sign In for Pricing
View Details