Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial
This Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial spans the amino acid sequence from region 1151-1266. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Doublecortin domain-containing protein 1; Doublecortin domain-containing 5 protein; DCDC1 DCDC5 KIAA1493
UniProt
M0R2J8
Expression Region
1151-1266
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
SCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVLVEKKSDGSHQRWIHQEDSRTFHLVSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNNGAANQKWHYM
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470236-500 1x 500 µL
Progesterone (6-5E-3F), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 