Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial

This Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial spans the amino acid sequence from region 1151-1266. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Doublecortin domain-containing protein 1; Doublecortin domain-containing 5 protein; DCDC1 DCDC5 KIAA1493

UniProt

M0R2J8

Expression Region

1151-1266

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVLVEKKSDGSHQRWIHQEDSRTFHLVSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNNGAANQKWHYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,7-Dibromonapthalene
TRC-D425760-250MG 250 mg

2,7-Dibromonapthalene

Sign In for Pricing
View Details
SERPINA5 Polyclonal Antibody
E-AB-14445-01 20 µL

SERPINA5 Polyclonal Antibody

Sign In for Pricing
View Details
SERPINA5 Polyclonal Antibody
E-AB-14445-02 60 µL

SERPINA5 Polyclonal Antibody

Sign In for Pricing
View Details
SERPINA5 Polyclonal Antibody
E-AB-14445-03 120 µL

SERPINA5 Polyclonal Antibody

Sign In for Pricing
View Details
SERPINA5 Polyclonal Antibody
E-AB-14445-04 200 µL

SERPINA5 Polyclonal Antibody

Sign In for Pricing
View Details
Human CRB2 activation kit by CRISPRa
GA117283 1 Kit

Human CRB2 activation kit by CRISPRa

Sign In for Pricing
View Details