Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial

This Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial spans the amino acid sequence from region 1151-1266. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Doublecortin domain-containing protein 1; Doublecortin domain-containing 5 protein; DCDC1 DCDC5 KIAA1493

UniProt

M0R2J8

Expression Region

1151-1266

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVLVEKKSDGSHQRWIHQEDSRTFHLVSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNNGAANQKWHYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N1-[2-(1-Piperazinyl)ethyl]-1,2-ethanediamine Hydrochloride
TRC-P481260-10MG 10 mg

N1-[2-(1-Piperazinyl)ethyl]-1,2-ethanediamine Hydrochloride

Sign In for Pricing
View Details
Anti-GFP Tag  (Goat Polyclonal)
G095 100 µg

Anti-GFP Tag (Goat Polyclonal)

Sign In for Pricing
View Details
RNF40 Recombinant Rabbit Monoclonal Antibody [JE46-30]
ET7109-46 100 µL

RNF40 Recombinant Rabbit Monoclonal Antibody [JE46-30]

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS700064 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Archaeosine Acetate Salt
TRC-A766660-1MG 1 mg

Archaeosine Acetate Salt

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF594 conjugate, 0.1mg/mL
BNC941505-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details