Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neural cell adhesion molecule L1-like protein (NCHL1), partial

This Recombinant Human Neural cell adhesion molecule L1-like protein (NCHL1), partial spans the amino acid sequence from region 35-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neural cell adhesion molecule L1-like protein; Close homolog of L1; [Cleaved into: Processed neural cell adhesion molecule L1-like protein] CHL1 CALL

UniProt

O00533

Expression Region

35-124

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR43 (NM_015131) Human Over-expression Lysate
LC429451 20 µg

WDR43 (NM_015131) Human Over-expression Lysate

Sign In for Pricing
View Details
Aquaporin 7 (AQP7) (NM_001170) Human Over-expression Lysate
LC420089 20 µg

Aquaporin 7 (AQP7) (NM_001170) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SAGE1 activation kit by CRISPRa
GA110770 1 Kit

Human SAGE1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mitochondrial Marker (AE-1), 0.2mg/mL
BNUB0905-500 1x 500 µL

Mitochondrial Marker (AE-1), 0.2mg/mL

Sign In for Pricing
View Details
OptiWell™ Sealing Mats for DW Plates
D3320-21S 50 Units/Pack

OptiWell™ Sealing Mats for DW Plates

Sign In for Pricing
View Details
CD44 Standard (HCAM/1097), CF647 conjugate, 0.1mg/mL
BNC471097-100 1x 100 µL

CD44 Standard (HCAM/1097), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details