Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vasopressin-neurophysin 2-copeptin (NEU2), partial

This Recombinant Human Vasopressin-neurophysin 2-copeptin (NEU2), partial spans the amino acid sequence from region 32-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vasopressin-neurophysin 2-copeptin; AVP-NPII; [Cleaved into: Arg-vasopressin; Arginine-vasopressin; Neurophysin 2; Neurophysin-II; Copeptin] AVP ARVP VP

UniProt

P01185

Expression Region

32-124

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAV37P-set siRNA/shRNA/RNAi Lentivector (Human)
48456091 4x 500 ng

TRNAV37P-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Trans-4-[[ (1,1-Dimethylethoxy) carbonyl]amino]cyclohexaneacetic acid
OR1035658-01 1 g

Trans-4-[[ (1,1-Dimethylethoxy) carbonyl]amino]cyclohexaneacetic acid

Sign In for Pricing
View Details
Trans-4-[[ (1,1-Dimethylethoxy) carbonyl]amino]cyclohexaneacetic acid
OR1035658-02 5 g

Trans-4-[[ (1,1-Dimethylethoxy) carbonyl]amino]cyclohexaneacetic acid

Sign In for Pricing
View Details
Trans-4-[[ (1,1-Dimethylethoxy) carbonyl]amino]cyclohexaneacetic acid
OR1035658-03 10 g

Trans-4-[[ (1,1-Dimethylethoxy) carbonyl]amino]cyclohexaneacetic acid

Sign In for Pricing
View Details
Trans-4-[[ (1,1-Dimethylethoxy) carbonyl]amino]cyclohexaneacetic acid
OR1035658-04 25 g

Trans-4-[[ (1,1-Dimethylethoxy) carbonyl]amino]cyclohexaneacetic acid

Sign In for Pricing
View Details
Trans-4-[[ (1,1-Dimethylethoxy) carbonyl]amino]cyclohexaneacetic acid
OR1035658-05 100 g

Trans-4-[[ (1,1-Dimethylethoxy) carbonyl]amino]cyclohexaneacetic acid

Sign In for Pricing
View Details