Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-opiomelanocortin (COLI), partial

This Recombinant Human Pro-opiomelanocortin (COLI), partial spans the amino acid sequence from region 237-267. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-opiomelanocortin; POMC; Corticotropin-lipotropin; [Cleaved into: NPP; Melanotropin gamma; Gamma-MSH; Potential peptide; Corticotropin; Adrenocorticotropic hormone; ACTH; Melanocyte-stimulating hormone alpha; Alpha-MSH; Melanotropin alpha; Corticotropin-like intermediary peptide; CLIP; Lipotropin beta; Beta-LPH; Lipotropin gamma; Gamma-LPH; Melanocyte-stimulating hormone beta; Beta-MSH; Melanotropin beta; Beta-endorphin; Met-enkephalin] POMC

UniProt

P01189

Expression Region

237-267

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CEACAM5/CD66e Antibody (COL-1 + CEA31 + C66/261) [Janelia Fluor 646]
NBP2-34597JF646 0.1 mL

Mouse Monoclonal CEACAM5/CD66e Antibody (COL-1 + CEA31 + C66/261) [Janelia Fluor 646]

Sign In for Pricing
View Details
Cyclin B1 Antibody (1A5)
N1632-01 40 µL

Cyclin B1 Antibody (1A5)

Sign In for Pricing
View Details
Cyclin B1 Antibody (1A5)
N1632-02 100 µL

Cyclin B1 Antibody (1A5)

Sign In for Pricing
View Details
Cyclin B1 Antibody (1A5)
N1632-03 200 µL

Cyclin B1 Antibody (1A5)

Sign In for Pricing
View Details
RPS20P5-set siRNA/shRNA/RNAi Lentivector (Human)
42240091 4x 500 ng

RPS20P5-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
1,2,3,4,6-Penta-O-benzoyl-D-mannopyranose
294379-01 5 g

1,2,3,4,6-Penta-O-benzoyl-D-mannopyranose

Sign In for Pricing
View Details