Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lutropin subunit beta (LSHB)

This Recombinant Human Lutropin subunit beta (LSHB) spans the amino acid sequence from region 21-141. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lutropin subunit beta; Lutropin beta chain; Luteinizing hormone subunit beta; LH-B; LSH-B; LSH-beta; LHB

UniProt

P01229

Expression Region

21-141

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Iodotoluic Acid
TRC-I708645-250MG 250 mg

5-Iodotoluic Acid

Sign In for Pricing
View Details
PADI2 Antibody
KC-1206-01 50 μL

PADI2 Antibody

Sign In for Pricing
View Details
PADI2 Antibody
KC-1206-02 100 µL

PADI2 Antibody

Sign In for Pricing
View Details
PADI2 Antibody
KC-1206-03 1 mL

PADI2 Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR562799 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
Leukotriene A4 hydrolase (LTA4H) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8F4]
TA500665AM 100 µL

Leukotriene A4 hydrolase (LTA4H) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8F4]

Sign In for Pricing
View Details