Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myoglobin (MYG)

This Recombinant Human Myoglobin (MYG) spans the amino acid sequence from region 2-154. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myoglobin; Nitrite reductase MB; EC 1.7.-.-; Pseudoperoxidase MB; EC 1.11.1.-; MB

UniProt

P02144

Expression Region

2-154

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syce1 3'UTR Lenti-reporter-Luc Vector
45942084 1.0 µg

Syce1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human MBD3L5 knockout cell line
ABC-KH9076 1 Vial

Human MBD3L5 knockout cell line

Sign In for Pricing
View Details
Sheep Preptin (PTN) ELISA Kit
MBS9349627-01 48 Well

Sheep Preptin (PTN) ELISA Kit

Sign In for Pricing
View Details
Sheep Preptin (PTN) ELISA Kit
MBS9349627-02 96 Well

Sheep Preptin (PTN) ELISA Kit

Sign In for Pricing
View Details
Sheep Preptin (PTN) ELISA Kit
MBS9349627-03 5x 96 Well

Sheep Preptin (PTN) ELISA Kit

Sign In for Pricing
View Details
Sheep Preptin (PTN) ELISA Kit
MBS9349627-04 10x 96 Well

Sheep Preptin (PTN) ELISA Kit

Sign In for Pricing
View Details