Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycophorin-A (GLPA), partial

This Recombinant Human Glycophorin-A (GLPA), partial spans the amino acid sequence from region 20-91. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycophorin-A; MN sialoglycoprotein; PAS-2; Sialoglycoprotein alpha; CD antigen CD235a; GYPA GPA MNS

UniProt

P02724

Expression Region

20-91

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nodal Overexpression Lysate (Native) - (Dry Ice)
NBL1-13706 0.1 mg

Nodal Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
VNN1 Rabbit Polyclonal Antibody
orb632530-01 50 µg

VNN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VNN1 Rabbit Polyclonal Antibody
orb632530-02 100 µg

VNN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Goat Pappalysin 2 ELISA Kit
MBS026240 Inquire

Goat Pappalysin 2 ELISA Kit

Sign In for Pricing
View Details
Nutlin 3a 1mg
A11501-1 1 mg

Nutlin 3a 1mg

Sign In for Pricing
View Details
Lentiviral mouse Bclaf3 shRNA (UAS) - Lentiviral mouse Bclaf3 shRNA (UAS, RFP) (25)
GTR15179519 1 Vial

Lentiviral mouse Bclaf3 shRNA (UAS) - Lentiviral mouse Bclaf3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details