Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inhibin alpha chain (INHA)

This Recombinant Human Inhibin alpha chain (INHA) spans the amino acid sequence from region 233-366. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Inhibin alpha chain INHA

UniProt

P05111

Expression Region

233-366

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GART (Trifunctional Purine Biosynthetic Protein Adenosine-3, PGFT, PRGS, MGC47764) (MaxLight 750) discontinued
127171-ML750 100 µL

GART (Trifunctional Purine Biosynthetic Protein Adenosine-3, PGFT, PRGS, MGC47764) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ZNF575 Antibody
A22366-50UG 50 µg

ZNF575 Antibody

Sign In for Pricing
View Details
Oprozomib
165752 2.5 mg

Oprozomib

Sign In for Pricing
View Details
SPAPB17E12.10c Antibody
orb858148 2 mg

SPAPB17E12.10c Antibody

Sign In for Pricing
View Details
SMCR7L, NT (SMCR7L, MID51, MIEF1, Mitochondrial dynamic protein MID51, Mitochondrial dynamic protein of 51kD, Mitochondrial elongation factor 1, Smith-Magenis syndrome chromosomal region candidate gene 7 protein-like) (Azide free) (HRP) discontinued
042041-HRP 200 µL

SMCR7L, NT (SMCR7L, MID51, MIEF1, Mitochondrial dynamic protein MID51, Mitochondrial dynamic protein of 51kD, Mitochondrial elongation factor 1, Smith-Magenis syndrome chromosomal region candidate gene 7 protein-like) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Mouse HORMA domain-containing protein 2 (Hormad2)
MBS1432547-01 0.02 mg (E-Coli)

Recombinant Mouse HORMA domain-containing protein 2 (Hormad2)

Sign In for Pricing
View Details