Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty acid-binding protein, heart (FABPH)

This Recombinant Human Fatty acid-binding protein, heart (FABPH) spans the amino acid sequence from region 2-133. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fatty acid-binding protein, heart; Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; H-FABP; Mammary-derived growth inhibitor; MDGI; Muscle fatty acid-binding protein; M-FABP; FABP3 FABP11 MDGI

UniProt

P05413

Expression Region

2-133

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac 3-Hydroxybutyric Acid-d4 Sodium Salt
TRC-H833022-5MG 5 mg

rac 3-Hydroxybutyric Acid-d4 Sodium Salt

Sign In for Pricing
View Details
Diisononyl Adipate (mixture of isomers)
TRC-D447135-5G 5 g

Diisononyl Adipate (mixture of isomers)

Sign In for Pricing
View Details
Tissue FFPE Sections, Duodenum
CS805196 5x 5 µm

Tissue FFPE Sections, Duodenum

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF594 conjugate, 0.1mg/mL
BNC941747-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human T Cell Helper,  20nm
GM-06-20 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human T Cell Helper, 20nm

Sign In for Pricing
View Details
CALCOCO2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7A7]
TA502106BM 100 µL

CALCOCO2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7A7]

Sign In for Pricing
View Details