Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty acid-binding protein, heart (FABPH)

This Recombinant Human Fatty acid-binding protein, heart (FABPH) spans the amino acid sequence from region 2-133. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fatty acid-binding protein, heart; Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; H-FABP; Mammary-derived growth inhibitor; MDGI; Muscle fatty acid-binding protein; M-FABP; FABP3 FABP11 MDGI

UniProt

P05413

Expression Region

2-133

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF174 Human shRNA Plasmid Kit (Locus ID 7727)
TR308239 1 Kit

ZNF174 Human shRNA Plasmid Kit (Locus ID 7727)

Sign In for Pricing
View Details
ENSA Adenovirus (Mouse)
19315055 1.0 mL

ENSA Adenovirus (Mouse)

Sign In for Pricing
View Details
TLL1 Protein Vector (Rat) (pPM-C-His)
PV310997 500 ng

TLL1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
SRBD1 Rabbit Polyclonal Antibody (FITC)
orb2719497 100 µg

SRBD1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Lentinan 100mg
A17518-100 100 mg

Lentinan 100mg

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS712357 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details