Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prostate-specific antigen (KLK3)

This Recombinant Human Prostate-specific antigen (KLK3) spans the amino acid sequence from region 25-261. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Prostate-specific antigen; PSA; EC 3.4.21.77; Gamma-seminoprotein; Seminin; Kallikrein-3; P-30 antigen; Semenogelase; KLK3 APS

UniProt

P07288

Expression Region

25-261

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SW-1353
ABC-TC1197 1 Vial

SW-1353

Sign In for Pricing
View Details
CBX7 (Chromobox Protein Homolog 7, CBX7) (Biotin)
MBS6454822-01 0.2 mL

CBX7 (Chromobox Protein Homolog 7, CBX7) (Biotin)

Sign In for Pricing
View Details
CBX7 (Chromobox Protein Homolog 7, CBX7) (Biotin)
MBS6454822-02 5x 0.2 mL

CBX7 (Chromobox Protein Homolog 7, CBX7) (Biotin)

Sign In for Pricing
View Details
XKR9 siRNA (m)
sc-155378 10 µM

XKR9 siRNA (m)

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae FPR2 Protein (aa 18-135) [His]
VAng-Wyb4656-1mg 1 mg

Recombinant Saccharomyces Cerevisiae FPR2 Protein (aa 18-135) [His]

Sign In for Pricing
View Details
Mouse Ehmt2 ELISA KIT
ELI-47578m 96 Tests

Mouse Ehmt2 ELISA KIT

Sign In for Pricing
View Details