Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pepsin A-3 (PEPA3)

This Recombinant Human Pepsin A-3 (PEPA3) spans the amino acid sequence from region 63-388. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pepsin A-3; EC 3.4.23.1; Pepsinogen-3; PGA3

UniProt

P0DJD8

Expression Region

63-388

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Propane 98%
P25040-01 100 g

Propane 98%

Sign In for Pricing
View Details
Propane 98%
P25040-02 300 g

Propane 98%

Sign In for Pricing
View Details
Pancreatic Polypeptide, human
MBS5763432 Inquire

Pancreatic Polypeptide, human

Sign In for Pricing
View Details
Olr1243 CRISPRa sgRNA lentivector (set of three targets)(Rat)
33775126 3x 1.0µg DNA

Olr1243 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Factor B (FB, Complement Factor B, CFB, AHUS4, BF, BFD, C3/C5 Convertase, CFAB, FBI12, Glycine-rich beta Glycoprotein, GBG, H2-Bf, PBF2, Properdin Factor B) (MaxLight 405) discontinued
F0009-10C-ML405 100 µL

Factor B (FB, Complement Factor B, CFB, AHUS4, BF, BFD, C3/C5 Convertase, CFAB, FBI12, Glycine-rich beta Glycoprotein, GBG, H2-Bf, PBF2, Properdin Factor B) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ARHGAP45 Polyclonal Antibody
MBS2559954-01 0.02 mL

ARHGAP45 Polyclonal Antibody

Sign In for Pricing
View Details