Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane domain-containing protein TMIGD3 (TMIG3), partial

This Recombinant Human Transmembrane domain-containing protein TMIGD3 (TMIG3), partial spans the amino acid sequence from region 76-212. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane domain-containing protein TMIGD3 TMIGD3 UNQ1931/PRO4406

UniProt

P0DMS9

Expression Region

76-212

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAFSPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLANDFWSGKDLSGNKTRSCKAPKVVRKADRSRTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTF3L4 CRISPRa sgRNA lentivector (set of three targets)(Human)
13532121 3x 1.0µg DNA

BTF3L4 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Vsig8 ORF Vector (Rat) (pORF)
50208016 1.0 µg DNA

Vsig8 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
MED8 Recombinant Protein (Mouse)
RP150113 100 µg

MED8 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
FREM2 siRNA Oligos set (Human)
20940171 3x 5 nmol

FREM2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
NAA25 Lentiviral Activation Particles (m2)
sc-433097-LAC-2 200 µL

NAA25 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
ASCL5 Protein Lysate (Human) with C-Ha Tag
12529031 100 µg

ASCL5 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details