Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 2 (IGLC2)

This Recombinant Human Immunoglobulin lambda constant 2 (IGLC2) spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda constant 2; Ig lambda chain C region Kern; Ig lambda chain C region NIG-64; Ig lambda chain C region SH; Ig lambda chain C region X; Ig lambda-2 chain C region; IGLC2

UniProt

P0DOY2

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF625 Human qPCR Primer Pair (NM_145233)
HP217414 200 Reactions

ZNF625 Human qPCR Primer Pair (NM_145233)

Sign In for Pricing
View Details
MID1 (Midline-1, Midin, Midline 1 RING Finger Protein, Putative Transcription Factor XPRF, RING Finger Protein 59, Tripartite Motif-containing Protein 18, FXY, RNF59, TRIM18, XPRF) (AP) discontinued
129682-AP 100 µL

MID1 (Midline-1, Midin, Midline 1 RING Finger Protein, Putative Transcription Factor XPRF, RING Finger Protein 59, Tripartite Motif-containing Protein 18, FXY, RNF59, TRIM18, XPRF) (AP) discontinued

Sign In for Pricing
View Details
4-[ (2,6-Dimethylphenoxy) methyl]benzoic acid
ZFA28834-01 0.5 g

4-[ (2,6-Dimethylphenoxy) methyl]benzoic acid

Sign In for Pricing
View Details
4-[ (2,6-Dimethylphenoxy) methyl]benzoic acid
ZFA28834-02 5 g

4-[ (2,6-Dimethylphenoxy) methyl]benzoic acid

Sign In for Pricing
View Details
CODESOFT Lite - Renew - SUB
11025-EAE 1 Each

CODESOFT Lite - Renew - SUB

Sign In for Pricing
View Details
PH Combination Electrode
E0754 1 PC

PH Combination Electrode

Sign In for Pricing
View Details