Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 3 (IGLC3)

This Recombinant Human Immunoglobulin lambda constant 3 (IGLC3) spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda constant 3; Ig lambda chain C region DOT; Ig lambda chain C region NEWM; Ig lambda-3 chain C regions; IGLC3

UniProt

P0DOY3

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Sialidase-1 (C-6His)
PHH1207-01 10 µg

Recombinant Human Sialidase-1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Sialidase-1 (C-6His)
PHH1207-02 50 µg

Recombinant Human Sialidase-1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Sialidase-1 (C-6His)
PHH1207-03 500 µg

Recombinant Human Sialidase-1 (C-6His)

Sign In for Pricing
View Details
Lentiviral human NDUFB5 shRNA (UAS) - Lentiviral human NDUFB5 shRNA (UAS, iRFP) plasmid
GTR15152920 1 Vial

Lentiviral human NDUFB5 shRNA (UAS) - Lentiviral human NDUFB5 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Human ACADM (NM_001127328) AAV Particle
RC225693A1V 250 µL

Human ACADM (NM_001127328) AAV Particle

Sign In for Pricing
View Details
Anti-MB (Ureaplasma urealyticum)
IT-503-015M1-01 0.1 mg

Anti-MB (Ureaplasma urealyticum)

Sign In for Pricing
View Details