Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 3 (IGLC3)

This Recombinant Human Immunoglobulin lambda constant 3 (IGLC3) spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda constant 3; Ig lambda chain C region DOT; Ig lambda chain C region NEWM; Ig lambda-3 chain C regions; IGLC3

UniProt

P0DOY3

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARAP2 shRNA Plasmid (h)
sc-60198-SH 20 µg

ARAP2 shRNA Plasmid (h)

Sign In for Pricing
View Details
Cplx4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3174707 1.0 µg DNA

Cplx4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
TLR5 (Toll-like Receptor 5, FLJ10052, MGC126430, MGC126431, SLEB1, TIL3) (Biotin)
252747-Biotin 100 µL

TLR5 (Toll-like Receptor 5, FLJ10052, MGC126430, MGC126431, SLEB1, TIL3) (Biotin)

Sign In for Pricing
View Details
OGG1 Recombinant Antibody, APC Conjugated
bsm-61557R-APC-TR 20 µL

OGG1 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Human Vitamin H (VH) ELISA Kit
MBS167274-01 48 Well

Human Vitamin H (VH) ELISA Kit

Sign In for Pricing
View Details
Human Vitamin H (VH) ELISA Kit
MBS167274-02 96 Well

Human Vitamin H (VH) ELISA Kit

Sign In for Pricing
View Details