Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLUR2)

This Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLUR2) spans the amino acid sequence from region 23-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secreted Ly-6/uPAR domain-containing protein 2; Secreted LY6/PLAUR domain-containing protein 2; Secreted Ly-6/uPAR-related protein 2; SLURP-2; SLURP2

UniProt

P0DP57

Expression Region

23-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ipo9 shRNA (UAS) - Lentiviral mouse Ipo9 shRNA (UAS, RFP) (100)
GTR15236880 1 Vial

Lentiviral mouse Ipo9 shRNA (UAS) - Lentiviral mouse Ipo9 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
RPL31P58 Adenovirus (Human)
41401051 1.0 mL

RPL31P58 Adenovirus (Human)

Sign In for Pricing
View Details
Leprel4 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7589902 1.0 µg DNA

Leprel4 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Rabbit Monoclonal Integrin beta 3/CD61 Antibody (ITGB3/2166R) [DyLight 405]
NBP3-08291V 100 µL

Rabbit Monoclonal Integrin beta 3/CD61 Antibody (ITGB3/2166R) [DyLight 405]

Sign In for Pricing
View Details
GFR alpha 3 Antibody : HRP (OAPB00021-HRP)
OAPB00021-100UG-HRP 0.1 mg

GFR alpha 3 Antibody : HRP (OAPB00021-HRP)

Sign In for Pricing
View Details
Retinol Binding Protein 5, Cellular (RBP5) Recombinant, Rabbit
156646-01 10 µg

Retinol Binding Protein 5, Cellular (RBP5) Recombinant, Rabbit

Sign In for Pricing
View Details