Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial

This Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endothelin-converting enzyme 2; ECE-2; EC 3.4.24.71; ECE2 KIAA0604 UNQ403/PRO740

UniProt

P0DPD6

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Protein Biochemistry

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNVALQELGAGSNMVEYKRATLRDEDAPETPVEGGASPDAMEVGKGASPFSPGPSPGMTPGTPRSSGLFWRVTCPHLRSISGLCSRTMVGFQKGTRQLLGSRTQLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Fut8 shRNA (UAS) - Lentiviral mouse Fut8 shRNA (UAS) plasmid
GTR15197491 1 Vial

Lentiviral mouse Fut8 shRNA (UAS) - Lentiviral mouse Fut8 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Mouse Gap junction alpha-6 protein (Gja6)
MBS7015697-01 0.02 mg

Recombinant Mouse Gap junction alpha-6 protein (Gja6)

Sign In for Pricing
View Details
Recombinant Mouse Gap junction alpha-6 protein (Gja6)
MBS7015697-02 0.1 mg

Recombinant Mouse Gap junction alpha-6 protein (Gja6)

Sign In for Pricing
View Details
Recombinant Mouse Gap junction alpha-6 protein (Gja6)
MBS7015697-03 5x 0.1 mg

Recombinant Mouse Gap junction alpha-6 protein (Gja6)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Thrombospondin 4 (THBS4)
MBS2073066-01 0.1 mL

HRP-Linked Polyclonal Antibody to Thrombospondin 4 (THBS4)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Thrombospondin 4 (THBS4)
MBS2073066-02 0.2 mL

HRP-Linked Polyclonal Antibody to Thrombospondin 4 (THBS4)

Sign In for Pricing
View Details