Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial

This Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endothelin-converting enzyme 2; ECE-2; EC 3.4.24.71; ECE2 KIAA0604 UNQ403/PRO740

UniProt

P0DPD6

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Protein Biochemistry

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNVALQELGAGSNMVEYKRATLRDEDAPETPVEGGASPDAMEVGKGASPFSPGPSPGMTPGTPRSSGLFWRVTCPHLRSISGLCSRTMVGFQKGTRQLLGSRTQLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2',4'-Dihydroxypropiophenone
sc-231265 25 g

2',4'-Dihydroxypropiophenone

Sign In for Pricing
View Details
Recombinant Cupriavidus pinatubonensis CTP synthase (pyrG), partial
MBS1348441 Inquire

Recombinant Cupriavidus pinatubonensis CTP synthase (pyrG), partial

Sign In for Pricing
View Details
GPR48 Rabbit Polyclonal Antibody (RBITC)
orb1041355 100 µL

GPR48 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Rabbit Polyclonal SPANXN4 Antibody [Biotin]
NBP2-98021B 0.1 mL

Rabbit Polyclonal SPANXN4 Antibody [Biotin]

Sign In for Pricing
View Details
Recombinant Human Mucin 7, Secreted (MUC7)
RPU55719-01 50 µg

Recombinant Human Mucin 7, Secreted (MUC7)

Sign In for Pricing
View Details
Recombinant Human Mucin 7, Secreted (MUC7)
RPU55719-02 100 µg

Recombinant Human Mucin 7, Secreted (MUC7)

Sign In for Pricing
View Details