Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial

This Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endothelin-converting enzyme 2; ECE-2; EC 3.4.24.71; ECE2 KIAA0604 UNQ403/PRO740

UniProt

P0DPD6

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Protein Biochemistry

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNVALQELGAGSNMVEYKRATLRDEDAPETPVEGGASPDAMEVGKGASPFSPGPSPGMTPGTPRSSGLFWRVTCPHLRSISGLCSRTMVGFQKGTRQLLGSRTQLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC2A1 Protein Vector (Rat) (pPM-C-HA)
PV305796 500 ng

SLC2A1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
SFTPA1 (Surfactant Protein A1, COLEC4, FLJ51913, SFTP1, SP-A, SP-A1) (MaxLight 550)
251577-ML550 100 µL

SFTPA1 (Surfactant Protein A1, COLEC4, FLJ51913, SFTP1, SP-A, SP-A1) (MaxLight 550)

Sign In for Pricing
View Details
(R)-2-((4-Aminophenethyl)amino)-1-phenylethanol
TRC-A625970-2.5G 2.5 g

(R)-2-((4-Aminophenethyl)amino)-1-phenylethanol

Sign In for Pricing
View Details
DHRS9 Antibody, HRP conjugated
CSB-PA006867DB01HU-01 50 µg

DHRS9 Antibody, HRP conjugated

Sign In for Pricing
View Details
DHRS9 Antibody, HRP conjugated
CSB-PA006867DB01HU-02 100 µg

DHRS9 Antibody, HRP conjugated

Sign In for Pricing
View Details
TNBS (Trinitrobenzenesulfonic acid) -BSA
900171BA 1 mg

TNBS (Trinitrobenzenesulfonic acid) -BSA

Sign In for Pricing
View Details