Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H3.Y (H3Y1)

This Recombinant Human Histone H3.Y (H3Y1) spans the amino acid sequence from region 2-136. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H3.Y; Histone H3.Y1; H3Y1

UniProt

P0DPK2

Expression Region

2-136

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ARTKQTARKATAWQAPRKPLATKAAGKRAPPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRREGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP8A2 Antibody
OACA10103-50UG 50 µg

ATP8A2 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal USP16 Antibody [Alexa Fluor 647]
NB100-81638AF647 0.1 mL

Rabbit Polyclonal USP16 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
SLC52A3 Protein Vector (Mouse) (pPB-N-His)
PV231127 500 ng

SLC52A3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
3',4'-Dichloropropiophenone
sc-238720 5 g

3',4'-Dichloropropiophenone

Sign In for Pricing
View Details
Killer Cell Immunoglobulin Like Receptor 2DS4 (KIR2DS4) Polyclonal Antibody
CAU25713-01 100 µL

Killer Cell Immunoglobulin Like Receptor 2DS4 (KIR2DS4) Polyclonal Antibody

Sign In for Pricing
View Details
Killer Cell Immunoglobulin Like Receptor 2DS4 (KIR2DS4) Polyclonal Antibody
CAU25713-02 200 µL

Killer Cell Immunoglobulin Like Receptor 2DS4 (KIR2DS4) Polyclonal Antibody

Sign In for Pricing
View Details