Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H3.Y (H3Y1)

This Recombinant Human Histone H3.Y (H3Y1) spans the amino acid sequence from region 2-136. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H3.Y; Histone H3.Y1; H3Y1

UniProt

P0DPK2

Expression Region

2-136

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ARTKQTARKATAWQAPRKPLATKAAGKRAPPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRREGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLK3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV711743 1.0 µg DNA

KLK3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
CBR4 CRISPR Knock Out 293T Cell Line (Human)
15118141 1x 10^6 Cells / 1.0 mL

CBR4 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
ATP6V1D Protein Vector (Human) (pPB-N-His)
PV003210 500 ng

ATP6V1D Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Human MMP26 / Matrix metalloproteinase-26 Recombinant Protein
R1256h 1 Each

Human MMP26 / Matrix metalloproteinase-26 Recombinant Protein

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD1d Antibody
JOT20486F 20Tests

PE/Cyanine5 Anti-Mouse CD1d Antibody

Sign In for Pricing
View Details
Mouse Neurofilament, Heavy Polypeptide ELISA Kit
MBS749646-01 48 Well

Mouse Neurofilament, Heavy Polypeptide ELISA Kit

Sign In for Pricing
View Details