Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human M1-specific T cell receptor alpha chain (TRAR1), partial

This Recombinant Human M1-specific T cell receptor alpha chain (TRAR1), partial spans the amino acid sequence from region 20-243. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

M1-specific T cell receptor alpha chain; TR alpha chain TRAV27*01J42*01C*01; TRA

UniProt

P0DSE1

Expression Region

20-243

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGGGSQGNLIFGKGTKLSVKPIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-500 1x 500 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
BNC880257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DC10), CF568 conjugate, 0.1mg/mL
BNC680021-100 1x 100 µL

Cytokeratin 18 (DC10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF488A conjugate, 0.1mg/mL
BNC882206-500 1x 500 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CA72/733), CF740 conjugate, 0.1mg/mL
BNC740733-500 1x 500 µL

TAG-72 / CA72.4 (CA72/733), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details