Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eosinophil cationic protein (ECP)

This Recombinant Human Eosinophil cationic protein (ECP) spans the amino acid sequence from region 28-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Eosinophil cationic protein; ECP; EC 3.1.27.-; Ribonuclease 3; RNase 3; RNASE3 ECP RNS3

UniProt

P12724

Expression Region

28-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tube1 siRNA Oligos set (Mouse)
48827174 3x 5 nmol

Tube1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Tesk1 (NM_031578) Rat Untagged Clone
RN208360 10 µg

Tesk1 (NM_031578) Rat Untagged Clone

Sign In for Pricing
View Details
Serotonin (5-HT, 5 Hydroxytryptamine) BioAssayTM ELISA Kit (Mouse) discontinued
203625-01 48 Tests

Serotonin (5-HT, 5 Hydroxytryptamine) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Serotonin (5-HT, 5 Hydroxytryptamine) BioAssayTM ELISA Kit (Mouse) discontinued
203625-02 96 Tests

Serotonin (5-HT, 5 Hydroxytryptamine) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Bischloroanthrabenzoxocinone
T37408 500 µg

Bischloroanthrabenzoxocinone

Sign In for Pricing
View Details
Phospholipid-PEG-Biotin (MW 2000)
MBS5816510 Inquire

Phospholipid-PEG-Biotin (MW 2000)

Sign In for Pricing
View Details