Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eosinophil cationic protein (ECP)

This Recombinant Human Eosinophil cationic protein (ECP) spans the amino acid sequence from region 28-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Eosinophil cationic protein; ECP; EC 3.1.27.-; Ribonuclease 3; RNase 3; RNASE3 ECP RNS3

UniProt

P12724

Expression Region

28-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF259/ZPR1 Recombinant Rabbit Monoclonal Antibody
orb2561614-01 25 µL

ZNF259/ZPR1 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ZNF259/ZPR1 Recombinant Rabbit Monoclonal Antibody
orb2561614-02 50 µL

ZNF259/ZPR1 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ZNF259/ZPR1 Recombinant Rabbit Monoclonal Antibody
orb2561614-03 100 µL

ZNF259/ZPR1 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Tau Antibody (pSer202/ pThr205), Clone AH36: RPE
MBS8005587-01 0.1 mg

Tau Antibody (pSer202/ pThr205), Clone AH36: RPE

Sign In for Pricing
View Details
Tau Antibody (pSer202/ pThr205), Clone AH36: RPE
MBS8005587-02 5x 0.1 mg

Tau Antibody (pSer202/ pThr205), Clone AH36: RPE

Sign In for Pricing
View Details
CSRP2 Polyclonal Conjugated Antibody
MBS9443161-01 0.1 mL (Biotin)

CSRP2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details