Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inosine-5'-monophosphate dehydrogenase 1 (IMDH1)

This Recombinant Human Inosine-5'-monophosphate dehydrogenase 1 (IMDH1) spans the amino acid sequence from region 2-514. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Inosine-5'-monophosphate dehydrogenase 1; IMP dehydrogenase 1; IMPD 1; IMPDH 1; EC 1.1.1.205; IMPDH-I; IMPDH1 IMPD1

UniProt

P20839

Expression Region

2-514

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPCS siRNA (Mouse)
MBS8238832-01 15 nmol

PPCS siRNA (Mouse)

Sign In for Pricing
View Details
PPCS siRNA (Mouse)
MBS8238832-02 30 nmol

PPCS siRNA (Mouse)

Sign In for Pricing
View Details
PPCS siRNA (Mouse)
MBS8238832-03 5x 30 nmol

PPCS siRNA (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal PI 3-Kinase p85 beta Antibody (PIK3R2/292) [PE]
NBP3-14138PE 0.1 mL

Mouse Monoclonal PI 3-Kinase p85 beta Antibody (PIK3R2/292) [PE]

Sign In for Pricing
View Details
Recombinant Yersinia Enterocolitica rnhB Protein (aa 1-198) (strain 8081)
VAng-Wyb1754-50gEcoli 50 µg (E. coli)

Recombinant Yersinia Enterocolitica rnhB Protein (aa 1-198) (strain 8081)

Sign In for Pricing
View Details
Hsa-miR-155-5p miRNA Mimic
CMH0138-01 5 nmol

Hsa-miR-155-5p miRNA Mimic

Sign In for Pricing
View Details