Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serpin B3 (SPB3)

This Recombinant Human Serpin B3 (SPB3) spans the amino acid sequence from region 1-390. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serpin B3; Protein T4-A; Squamous cell carcinoma antigen 1; SCCA-1; SERPINB3 SCCA SCCA1

UniProt

P29508

Expression Region

1-390

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alg12 Mouse Gene Knockout Kit (CRISPR)
KN501135 1 Kit

Alg12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APEX2 Antibody (Biotin)
KB-7308-01 50 μL

APEX2 Antibody (Biotin)

Sign In for Pricing
View Details
APEX2 Antibody (Biotin)
KB-7308-02 100 µL

APEX2 Antibody (Biotin)

Sign In for Pricing
View Details
APEX2 Antibody (Biotin)
KB-7308-03 1 mL

APEX2 Antibody (Biotin)

Sign In for Pricing
View Details
TXN Rabbit Polyclonal Antibody
TA362611 100 µL

TXN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Swine CXCL11 protein (His Tag)
PKSS000022-01 5 µg

Recombinant Swine CXCL11 protein (His Tag)

Sign In for Pricing
View Details