Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-adrenomedullin (ADML), partial

This Recombinant Human Pro-adrenomedullin (ADML), partial spans the amino acid sequence from region 95-146. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-adrenomedullin [Cleaved into: Adrenomedullin; AM; Proadrenomedullin N-20 terminal peptide; ProAM N-terminal 20 peptide; PAMP; ProAM-N20] ADM AM

UniProt

P35318

Expression Region

95-146

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1700001C19Rik (NM_029296) Mouse Tagged ORF Clone
MG202261 10 µg

1700001C19Rik (NM_029296) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SYT2 pThr202 Rabbit Polyclonal Antibody
AP09492PU-N 100 µL

SYT2 pThr202 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD43 Mouse Monoclonal Antibody [A2F8]
EM1901-70 100 µL

CD43 Mouse Monoclonal Antibody [A2F8]

Sign In for Pricing
View Details
Frozen Tissue Sections, Urinary bladder
CS644459 5x 5 µm

Frozen Tissue Sections, Urinary bladder

Sign In for Pricing
View Details
TRIM21 Recombinant Rabbit monoclonal Antibody
HA750819 100 µL

TRIM21 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TTF1 (NKX2-1) (NM_003317) Human Over-expression Lysate
LY401141 100 µg

TTF1 (NKX2-1) (NM_003317) Human Over-expression Lysate

Sign In for Pricing
View Details