Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-adrenomedullin (ADML), partial

This Recombinant Human Pro-adrenomedullin (ADML), partial spans the amino acid sequence from region 95-146. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-adrenomedullin [Cleaved into: Adrenomedullin; AM; Proadrenomedullin N-20 terminal peptide; ProAM N-terminal 20 peptide; PAMP; ProAM-N20] ADM AM

UniProt

P35318

Expression Region

95-146

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HMP19 Protein - (Dry Ice)
H00051617-P01-10ug 10 µg

Recombinant Human HMP19 Protein - (Dry Ice)

Sign In for Pricing
View Details
Defensin 3, beta (Human) - Purified IgG Antibody
G-072-42 200 µg

Defensin 3, beta (Human) - Purified IgG Antibody

Sign In for Pricing
View Details
Goat Polyclonal RFC2 Antibody [DyLight 680]
NB100-231FR 0.1 mL

Goat Polyclonal RFC2 Antibody [DyLight 680]

Sign In for Pricing
View Details
CD169 Antibody
orb222739 0.1 mg

CD169 Antibody

Sign In for Pricing
View Details
HLA-X Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV762825 1.0 µg DNA

HLA-X Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Protein diaphanous homolog 3 (DIAPH3) Mouse ELISA Kit
G2662 96 Tests

Protein diaphanous homolog 3 (DIAPH3) Mouse ELISA Kit

Sign In for Pricing
View Details